Novus Biologicals
Manufacturer Code:NBP230425
Catalog # NBP230425
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Anion transporter/exchanger protein 9; Anion transporter/exchanger protein 9 anion transporter/exchanger-9 solute carrier family 26 member 9 solute carrier family 26 member 9; anion transporter/exchanger-9; solute carrier family 26 (anion exchanger), member 9; Solute carrier family 26 member 9; solute carrier family 26, member 9
Gene Aliases: SLC26A9
UniProt ID: (Human) Q7LBE3
Entrez Gene ID: (Human) 115019
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.