Novus Biologicals
Manufacturer Code:NBP17071720UL
Catalog # NBP17071720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC26A8(solute carrier family 26 member 8) The peptide sequence was selected from the C terminal of SLC26A8. Peptide sequence EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Anion exchange transporter; anion transporter/exchanger-8; SLC26A8; solute carrier family 26 (anion exchanger), member 8; Solute carrier family 26 member 8; Testis anion transporter 1
Gene Aliases: SLC26A8; SPGF3; TAT1
UniProt ID: (Human) Q96RN1
Entrez Gene ID: (Human) 116369
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.