Novus Biologicals
Manufacturer Code:NBP160106
Catalog # NBP160106
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC26A4(solute carrier family 26 member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DFNB4 EVA PDSTDH2B pendrin Sodium-independent chloride/iodide transporter Solute carrier family 26 member 4 solute carrier family 26 member 4; Pendrin; Sodium-independent chloride/iodide transporter; solute carrier family 26 (anion exchanger), member 4; Solute carrier family 26 member 4; truncated solute carrier family 26
Gene Aliases: DFNB4; EVA; PDS; SLC26A4; TDH2B
UniProt ID: (Human) O43511
Entrez Gene ID: (Human) 5172
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.