Novus Biologicals
Manufacturer Code:NBP180522
Catalog # NBP180522
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human Slc26a2. Peptide sequence VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D5S1708 Diastrophic dysplasia protein diastrophic dysplasia sulfate transporter DTDMSTP157 DTDSTMST153 EDM4 solute carrier family 26 (sulfate transporter) member 2 Solute carrier family 26 member 2 sulfate anion transporter 1 sulfate transporter; Diastrophic dysplasia protein; solute carrier family 26 (anion exchanger), member 2; solute carrier family 26 (sulfate transporter), member 2; Solute carrier family 26 member 2; sulfate anion transporter 1; Sulfate transporter
Gene Aliases: D5S1708; DTD; DTDST; EDM4; MST153; MSTP157; SLC26A2
UniProt ID: (Human) P50443
Entrez Gene ID: (Human) 1836
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.