Novus Biologicals
Manufacturer Code:NBP159408
Catalog # NBP159408
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC26A1(solute carrier family 26 (sulfate transporter) member 1) The peptide sequence was selected from the C terminal of SLC26A1. Peptide sequence LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EDM4 SAT1 SAT-1sulfate anion transporter 1 solute carrier family 26 (sulfate transporter) member 1 Solute carrier family 26 member 1 sulfate anion tranporter AT1 sulfate transporter sulfate/anion transporter SAT-1 protein; SAT-1; solute carrier family 26 (anion exchanger), member 1; solute carrier family 26 (sulfate transporter), member 1; Solute carrier family 26 member 1; sulfate anion tranporter AT1; Sulfate anion transporter 1; sulfate/anion transporter SAT-1 protein
Gene Aliases: CAON; EDM4; SAT-1; SAT1; SLC26A1
UniProt ID: (Human) Q9H2B4
Entrez Gene ID: (Human) 10861
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.