Novus Biologicals
Manufacturer Code:NBP159600
Catalog # NBP159600
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC25A39(solute carrier family 25 member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI69 CGI-69 FLJ22407 solute carrier family 25 member 39 solute carrier family 25 member 39; Solute carrier family 25 member 39
Gene Aliases: CGI-69; CGI69; PRO2163; SLC25A39
UniProt ID: (Human) Q9BZJ4
Entrez Gene ID: (Human) 51629
Molecular Function: RNA binding protein amino acid transporter calcium-binding protein calmodulin intracellular calcium-sensing protein mitochondrial carrier protein nucleic acid binding ribosomal protein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.