Novus Biologicals
Manufacturer Code:NBP15949920UL
Catalog # NBP15949920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC25A29(solute carrier family 25 member 29) The peptide sequence was selected from the C terminal of SLC25A29. Peptide sequence AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C14orf69 CACL CACT-like carnitine-acylcarnitine translocase like chromosome 14 open reading frame 69 FLJ38975 mitochondrial carnitine/acylcarnitine carrier protein CACL Solute carrier family 25 member 29 solute carrier family 25 member 29; CACT-like; carnitine-acylcarnitine translocase like; Carnitine/acylcarnitine translocase-like; Mitochondrial basic amino acids transporter; Mitochondrial carnitine/acylcarnitine carrier protein CACL; Mitochondrial ornithine transporter 3; solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29; Solute carrier family 25 member 29; solute carrier family 25, member 29
Gene Aliases: C14orf69; CACL; ORNT3; SLC25A29
UniProt ID: (Human) Q8N8R3
Entrez Gene ID: (Human) 123096
Molecular Function:
RNA binding protein
amino acid transporter
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
mitochondrial carrier protein
nucleic acid binding
ribosomal protein
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.