Novus Biologicals
Manufacturer Code:NBP15955720UL
Catalog # NBP15955720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier phosphate carrier) member 24) The peptide sequence was selected from the N terminal of SLC25A24. Peptide sequence MDSLYGDLFWYLDYNKDGTLDIFELQEGLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APC1calcium-binding mitochondrial carrier protein SCaMC-1 calcium-binding transporter DKFZp586G0123 MCSC1 Mitochondrial ATP-Mg/Pi carrier protein 1 mitochondrial ATP-Mg/Pi transporter Mitochondrial Ca(2+)-dependent solute carrier protein 1 SCAMC1 SCAMC-1 short calcium-binding mitochondrial carrier 1 Small calcium-binding mitochondrial carrier protein 1 solute carrier family 25 (mitochondrial carrier phosphate carrier) member 24 Solute carrier family 25 member 24; Calcium-binding mitochondrial carrier protein SCaMC-1; calcium-binding transporter; Mitochondrial ATP-Mg/Pi carrier protein 1; Mitochondrial Ca(2+)-dependent solute carrier protein 1; short calcium-binding mitochondrial carrier 1; Small calcium-binding mitochondrial carrier protein 1; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24; Solute carrier family 25 member 24
Gene Aliases: APC1; MCSC1; SCAMC-1; SCAMC1; SLC25A24
UniProt ID: (Human) Q6NUK1
Entrez Gene ID: (Human) 29957
Molecular Function:
RNA binding protein
amino acid transporter
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
mitochondrial carrier protein
nucleic acid binding
ribosomal protein
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.