Novus Biologicals
Manufacturer Code:NBP15958120UL
Catalog # NBP1595820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC25A21(solute carrier family 25 (mitochondrial oxodicarboxylate carrier) member 21) The peptide sequence was selected from the N terminal of SLC25A21. Peptide sequence FYKGILPPILAETPKRAVKFFTFEQYKKLLGY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC126570 ODC1 ODCmitochondrial 2-oxodicarboxylate carrier oxodicarboxylate carrier solute carrier family 25 (mitochondrial oxodicarboxylate carrier) member 21 Solute carrier family 25 member 21; Mitochondrial 2-oxodicarboxylate carrier; oxodicarboxylate carrier; solute carrier family 25 (mitochondrial oxoadipate carrier), member 21; solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21; Solute carrier family 25 member 21
Gene Aliases: ODC; ODC1; SLC25A21
UniProt ID: (Human) Q9BQT8
Entrez Gene ID: (Human) 89874
Molecular Function: RNA binding protein amino acid transporter calcium-binding protein calmodulin intracellular calcium-sensing protein mitochondrial carrier protein nucleic acid binding ribosomal protein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.