Novus Biologicals
Manufacturer Code:NBP230684
Catalog # NBP230684
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 34 kDa peroxisomal membrane protein; 34 kDa peroxisomal membrane protein peroxisomal membrane protein (34kD) peroxisomal membrane protein PMP34 PMP34 Solute Carrier Family 25 (Mitochondrial Carrier Peroxisomal Membrane Protein 34kD) Member 17 Solute Carrier Family 25 Member 17; Peroxisomal membrane protein PMP34; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17; Solute carrier family 25 member 17
Gene Aliases: PMP34; SLC25A17
UniProt ID: (Human) O43808
Entrez Gene ID: (Human) 10478
Molecular Function:
RNA binding protein
amino acid transporter
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
mitochondrial carrier protein
nucleic acid binding
ribosomal protein
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.