Novus Biologicals
Manufacturer Code:NBP213320
Catalog # NBP213320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTACVLTGQPFDTIKVKMQTFPDLYKGLTD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D13S327 mitochondrial ornithine transporter 1 ORC1 ornithine transporter 1 ORNT1HHH solute carrier family 25 (mitochondrial carrier ornithine transporter) member15 Solute carrier family 25 member 15; Mitochondrial ornithine transporter 1; ornithine transporter 1; solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15; Solute carrier family 25 member 15
Gene Aliases: D13S327; HHH; ORC1; ORNT1; SLC25A15; SP1855
UniProt ID: (Human) Q9Y619
Entrez Gene ID: (Human) 10166
Molecular Function:
RNA binding protein
amino acid transporter
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
mitochondrial carrier protein
nucleic acid binding
ribosomal protein
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.