Novus Biologicals
Manufacturer Code:NBP189019
Catalog # NBP189019
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARALAR2CTLN2 calcium-binding mitochondrial carrier protein Aralar2 Citrin Mitochondrial aspartate glutamate carrier 2 Solute carrier family 25 member 13 solute carrier family 25 member 13 (citrin); Calcium-binding mitochondrial carrier protein Aralar2; Citrin; Mitochondrial aspartate glutamate carrier 2; solute carrier family 25 (aspartate/glutamate carrier), member 13; Solute carrier family 25 member 13
Gene Aliases: ARALAR2; CITRIN; CTLN2; SLC25A13
UniProt ID: (Human) O14575
Entrez Gene ID: (Human) 10165
Molecular Function: RNA binding protein amino acid transporter calcium-binding protein calmodulin intracellular calcium-sensing protein mitochondrial carrier protein nucleic acid binding ribosomal protein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.