Novus Biologicals
Manufacturer Code:NBP189020
Catalog # NBP189020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AGC1 araceli hiperlarga ARALAR ARALAR1 calcium binding mitochondrial carrier superfamily member Aralar1 calcium-binding mitochondrial carrier protein Aralar1 Mitochondrial aspartate glutamate carrier 1 solute carrier family 25 (mitochondrial carrier Aralar) member 12 Solute carrier family 25 member 12; araceli hiperlarga; calcium binding mitochondrial carrier superfamily member Aralar1; Calcium-binding mitochondrial carrier protein Aralar1; Mitochondrial aspartate glutamate carrier 1; solute carrier family 25 (aspartate/glutamate carrier), member 12; solute carrier family 25 (mitochondrial carrier, Aralar), member 12; Solute carrier family 25 member 12
Gene Aliases: AGC1; ARALAR; ARALAR1; SLC25A12
UniProt ID: (Human) O75746
Entrez Gene ID: (Human) 8604
Molecular Function: RNA binding protein amino acid transporter calcium-binding protein calmodulin intracellular calcium-sensing protein mitochondrial carrier protein nucleic acid binding ribosomal protein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.