Novus Biologicals
Manufacturer Code:NBP182490
Catalog # NBP182490
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Mitochondrial 2-oxoglutarate/malate carrier protein; OGCmitochondrial 2-oxoglutarate/malate carrier protein OGCP SLC20A4solute carrier family 20 (oxoglutarate carrier) member 4 solute carrier family 25 (mitochondrial carrier oxoglutarate carrier) member11 Solute carrier family 25 member 11; OGCP; solute carrier family 20 (oxoglutarate carrier), member 4; solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11; Solute carrier family 25 member 11
Gene Aliases: OGC; SLC20A4; SLC25A11
UniProt ID: (Human) Q02978
Entrez Gene ID: (Human) 8402
Molecular Function: RNA binding protein amino acid transporter calcium-binding protein calmodulin intracellular calcium-sensing protein mitochondrial carrier protein nucleic acid binding ribosomal protein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.