Novus Biologicals
Manufacturer Code:NBP183607
Catalog # NBP183607
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22233 NCKX6Na(+)/K(+)/Ca(2+)-exchange protein 6 NCLX sodium/potassium/calcium exchanger 6 solute carrier family 24 (sodium/potassium/calcium exchanger) member 6 Solute carrier family 24 member 6; Mitochondrial sodium/calcium exchanger protein; Na(+)/K(+)/Ca(2+)-exchange protein 6; Sodium/calcium exchanger protein, mitochondrial; Sodium/potassium/calcium exchanger 6; solute carrier family 24 (sodium/lithium/calcium exchanger), member 6; solute carrier family 24 (sodium/potassium/calcium exchanger), member 6; Solute carrier family 24 member 6; solute carrier family 8 (sodium/lithium/calcium exchanger), member B1; Solute carrier family 8 member B1
Gene Aliases: NCKX6; NCLX; SLC24A6; SLC8B1
UniProt ID: (Human) Q6J4K2
Entrez Gene ID: (Human) 80024
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.