Novus Biologicals
Manufacturer Code:NBP159897
Catalog # NBP159897
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC24A4(solute carrier family 24 (sodium/potassium/calcium exchanger) member 4) The peptide sequence was selected from the N terminal of SLC24A4. Peptide sequence PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/K(+)/Ca(2+)-exchange protein 4; Na(+)/K(+)/Ca(2+)-exchange protein 4 NCKX4FLJ38852 SHEP6 SLC24A2 sodium/potassium/calcium exchanger 4 solute carrier family 24 (sodium/potassium/calcium exchanger) member 4 Solute carrier family 24 member 4; Sodium/potassium/calcium exchanger 4; solute carrier family 24 (sodium/potassium/calcium exchanger), member 4; Solute carrier family 24 member 4
Gene Aliases: AI2A5; NCKX4; SHEP6; SLC24A2; SLC24A4
UniProt ID: (Human) Q8NFF2
Entrez Gene ID: (Human) 123041
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.