Novus Biologicals
Manufacturer Code:NBP192397
Catalog # NBP192397
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SSHQPIKLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAKMIPTTTKNNYSPTAAGTERRKED |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HsT17412 KIAA0702Na(+)/K(+)/Ca(2+)-exchange protein 1 NCKX NCKX1Retinal rod Na-Ca+K exchanger retinal rod Na+/Ca+/K+ exchanger RODX sodium/potassium/calcium exchanger 1 solute carrier family 24 (sodium/potassium/calcium exchanger) member 1; Na(+)/K(+)/Ca(2+)-exchange protein 1; retinal rod Na+/Ca+/K+ exchanger; Retinal rod Na-Ca+K exchanger; Sodium/potassium/calcium exchanger 1; solute carrier family 24 (sodium/potassium/calcium exchanger), member 1; Solute carrier family 24 member 1
Gene Aliases: CSNB1D; HsT17412; KIAA0702; NCKX; NCKX1; RODX; SLC24A1
UniProt ID: (Human) O60721
Entrez Gene ID: (Human) 9187
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.