Novus Biologicals
Manufacturer Code:NBP213318
Catalog # NBP213318
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYI PICPVFKGFSSSSKDQIAIPEDTPENTETAS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hSVCT1; hSVCT1 SLC23A2 Sodium-dependent vitamin C transporter 1 sodium-dependent vitamin C transporter-1 solute carrier family 23 (nucleobase transporters) member 1 solute carrier family 23 (nucleobase transporters) member 2 solute carrier family 23 member 1 SVCT1Na(+)/L-ascorbic acid transporter 1 Yolk sac permease-like molecule 3 YSPL3MGC22361; Na(+)/L-ascorbic acid transporter 1; Sodium-dependent vitamin C transporter 1; sodium-dependent vitamin C transporter-1; solute carrier family 23 (ascorbic acid transporter), member 1; solute carrier family 23 (nucleobase transporters), member 1; solute carrier family 23 (nucleobase transporters), member 2; Solute carrier family 23 member 1; Yolk sac permease-like molecule 3
Gene Aliases: SLC23A1; SLC23A2; SVCT1; YSPL3
UniProt ID: (Human) Q9UHI7
Entrez Gene ID: (Human) 9963
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.