Novus Biologicals
Manufacturer Code:NBP169694
Catalog # NBP169694
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A6(solute carrier family 22 (organic anion transporter) member 6) The peptide sequence was selected from the N terminal of SLC22A6. Peptide sequence AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hOAT1; hOAT1 hPAHT hROAT1 MGC45260 OAT1FLJ55736 Organic anion transporter 1 PAH transporter PAHTHOAT1 para-aminohippurate transporter Renal organic anion transporter 1 ROAT1 solute carrier family 22 (organic anion transporter) member 6 solute carrier family 22 member 6; hPAHT; hROAT1; Organic anion transporter 1; PAH transporter; para-aminohippurate transporter; Renal organic anion transporter 1; solute carrier family 22 (organic anion transporter), member 6; Solute carrier family 22 member 6
Gene Aliases: HOAT1; OAT1; PAHT; ROAT1; SLC22A6
UniProt ID: (Human) Q4U2R8
Entrez Gene ID: (Human) 9356
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.