Novus Biologicals
Manufacturer Code:NBP18052920UL
Catalog # NBP18052920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human Slc22a3. Peptide sequence TSSELSCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWML. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EMT; EMT organic cation transporter 3; EMTEMTH Extraneuronal monoamine transporter OCT3EMT organic cation transporter 3 Organic cation transporter 3 solute carrier family 22 (extraneuronal monoamine transporter) member 3 solute carrier family 22 member 3; Extraneuronal monoamine transporter; Organic cation transporter 3; solute carrier family 22 (extraneuronal monoamine transporter), member 3; solute carrier family 22 (organic cation transporter), member 3; Solute carrier family 22 member 3
Gene Aliases: EMT; EMTH; OCT3; SLC22A3
UniProt ID: (Human) O75751
Entrez Gene ID: (Human) 6581
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.