Novus Biologicals
Manufacturer Code:NBP160040
Catalog # NBP160040
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter) member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Carnitine transporter 2; Carnitine transporter 2 CT2Organic cation/carnitine transporter 6 Flipt 2 FLIPT2member 16 fly-like putative organic ion transporter 2 Fly-like putative transporter 2 organic cation transporter 6 Organic cation transporter OKB1 solute carrier family 22 (organic cation/carnitine transporter) member 16 solute carrier family 22 member 16; CT2; epididymis secretory protein Li 18; flipt 2; FLIPT2; fly-like putative organic ion transporter 2; Fly-like putative transporter 2; organic cation transporter 6; Organic cation transporter OKB1; Organic cation/carnitine transporter 6; solute carrier family 22 (organic cation transporter), member 16; solute carrier family 22 (organic cation/carnitine transporter), member 16; Solute carrier family 22 member 16; WUGSC:RG331P03.1
Gene Aliases: CT2; dJ261K5.1; FLIPT2; HEL-S-18; OAT6; OCT6; OKB1; SLC22A16
UniProt ID: (Human) Q86VW1
Entrez Gene ID: (Human) 85413
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.