Novus Biologicals
Manufacturer Code:NBP184662
Catalog # NBP184662
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp761G0313 Flipt 1 FLIPT1PRO34686 fly-like putative organic ion transporter 1 Fly-like putative transporter 1 solute carrier family 22 (organic cation transporter) member 15 solute carrier family 22 member 15 solute carrier family 22 member 15 trans-like protein; Flipt 1; fly-like putative organic ion transporter 1; Fly-like putative transporter 1; solute carrier family 22 (organic cation transporter), member 15; Solute carrier family 22 member 15; solute carrier family 22, member 15; trans-like protein
Gene Aliases: FLIPT1; PRO34686; SLC22A15; UNQ9429/PRO34686
UniProt ID: (Human) Q8IZD6
Entrez Gene ID: (Human) 55356
Molecular Function: carbohydrate transporter cation transporter transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.