Novus Biologicals
Manufacturer Code:NBP16242020UL
Catalog # NBP16242020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A15(solute carrier family 22 member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp761G0313 Flipt 1 FLIPT1PRO34686 fly-like putative organic ion transporter 1 Fly-like putative transporter 1 solute carrier family 22 (organic cation transporter) member 15 solute carrier family 22 member 15 solute carrier family 22 member 15 trans-like protein; Flipt 1; fly-like putative organic ion transporter 1; Fly-like putative transporter 1; solute carrier family 22 (organic cation transporter), member 15; Solute carrier family 22 member 15; solute carrier family 22, member 15; trans-like protein
Gene Aliases: FLIPT1; PRO34686; SLC22A15; UNQ9429/PRO34686
UniProt ID: (Human) Q8IZD6
Entrez Gene ID: (Human) 55356
Molecular Function: carbohydrate transporter cation transporter transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.