Novus Biologicals
Manufacturer Code:NBP182502
Catalog # NBP182502
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: OAT10 OCTL1 OCTL3 ORCTL3 ORCTL-3 Organic cation transporter-like 3 organic cationic transporter-like 3 organic-cation transporter like 3 solute carrier family 22 (organic anion transporter) member 13 solute carrier family 22 member 13 solute carrier family 22 member 13; ORCTL-3; Organic cation transporter-like 3; organic cationic transporter-like 3; organic-cation transporter like 3; solute carrier family 22 (organic anion transporter), member 13; solute carrier family 22 (organic anion/urate transporter), member 13; Solute carrier family 22 member 13; solute carrier family 22, member 13
Gene Aliases: OAT10; OCTL1; OCTL3; ORCTL-3; ORCTL3; SLC22A13
UniProt ID: (Human) Q9Y226
Entrez Gene ID: (Human) 9390
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.