Novus Biologicals
Manufacturer Code:NBP182500
Catalog # NBP182500
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: OATL4 Organic anion transporter 4-like protein Renal-specific transporter RSTmember 12 solute carrier family 22 (organic anion/urate transporter) member 12 URAT1 URAT1Urate anion exchanger 1 urate transporter 1; Organic anion transporter 4-like protein; Renal-specific transporter; RST; solute carrier family 22 (organic anion/cation transporter), member 12; solute carrier family 22 (organic anion/urate transporter), member 12; Solute carrier family 22 member 12; Urate anion exchanger 1; urate transporter 1
Gene Aliases: OAT4L; OATL4; RST; SLC22A12; UNQ6453/PRO34004; URAT1
UniProt ID: (Human) Q96S37
Entrez Gene ID: (Human) 116085
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.