Novus Biologicals
Manufacturer Code:NBP169536
Catalog # NBP169536
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A11(solute carrier family 22 (organic anion/urate transporter) member 11) The peptide sequence was selected from the C terminal of SLC22A11. Peptide sequence ASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hOAT4 MGC34282 OAT4solute carrier family 22 (organic anion/cation transporter) member 11 Organic anion transporter 4 solute carrier family 22 (organic anion/urate transporter) member 11 solute carrier family 22 member 11; Organic anion transporter 4; solute carrier family 22 (organic anion/cation transporter), member 11; solute carrier family 22 (organic anion/urate transporter), member 11; Solute carrier family 22 member 11
Gene Aliases: hOAT4; OAT4; SLC22A11
UniProt ID: (Human) Q9NSA0
Entrez Gene ID: (Human) 55867
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.