Novus Biologicals
Manufacturer Code:NBP159464
Catalog # NBP159464
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC22A1(solute carrier family 22 (organic cation transporter) member 1) The peptide sequence was selected from the N terminal of SLC22A1 (NP_003048). Peptide sequence LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hOCT1; hOCT1 oct1_cds OCT1solute carrier family 22 member 1 Organic cation transporter 1 solute carrier family 22 (organic cation transporter) member 1; Organic cation transporter 1; solute carrier family 22 (organic cation transporter), member 1; Solute carrier family 22 member 1
Gene Aliases: HOCT1; OCT1; oct1_cds; SLC22A1
UniProt ID: (Human) O15245
Entrez Gene ID: (Human) 6580
Molecular Function:
carbohydrate transporter
cation transporter
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.