Novus Biologicals
Manufacturer Code:NBP169702
Catalog # NBP169702
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC20A2(solute carrier family 20 (phosphate transporter) member 2) The peptide sequence was selected from the N terminal of SLC20A2. Peptide sequence DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Gibbon ape leukemia virus receptor 2; Gibbon ape leukemia virus receptor 2 Glvr-2 GLVR2PIT-2 hPit2 MLVAR murine leukemia virus amphotropic receptor for Phosphate transporter 2 pit2 PiT-2 sodium-dependent phosphate transporter 2 solute carrier family 20 (phosphate transporter) member 2 Solute carrier family 20 member 2; GLVR-2; murine leukemia virus, amphotropic, receptor for; murine leukemia virus, amphotropic; receptor; Phosphate transporter 2; PiT-2; Sodium-dependent phosphate transporter 2; solute carrier family 20 (phosphate transporter), member 2; Solute carrier family 20 member 2
Gene Aliases: GLVR-2; GLVR2; IBGC1; IBGC3; MLVAR; PIT-2; PIT2; Ram-1; RAM1; SLC20A2
UniProt ID: (Human) Q08357
Entrez Gene ID: (Human) 6575
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.