Novus Biologicals
Manufacturer Code:NBP159059
Catalog # NBP159059
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC20A1(solute carrier family 20 (phosphate transporter) member 1) The peptide sequence was selected from the C terminal of SLC20A1. Peptide sequence LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ41426 Gibbon ape leukemia virus receptor 1 Glvr-1 GLVR1DKFZp686J2397 Leukemia virus receptor 1 homolog Phosphate transporter 1 PiT-1PIT1 sodium-dependent phosphate transporter 1 solute carrier family 20 (phosphate transporter) member 1 Solute carrier family 20 member 1; Gibbon ape leukemia virus receptor 1; GLVR-1; Leukemia virus receptor 1 homolog; Phosphate transporter 1; PiT-1; Sodium-dependent phosphate transporter 1; solute carrier family 20 (phosphate transporter), member 1; Solute carrier family 20 member 1
Gene Aliases: Glvr-1; GLVR1; PiT-1; PIT1; SLC20A1
UniProt ID: (Human) Q8WUM9
Entrez Gene ID: (Human) 6574
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.