Novus Biologicals
Manufacturer Code:NBP213317
Catalog # NBP213317
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFA LDLTPPPEVVYKSEPGTSDGM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAAT EAAT5 excitatory amino acid transporter 5 (retinal glutamate transporter) excitatory amino acid transporter 5a long retinal glutamate transporter solute carrier family 1 (glutamate transporter) member 7; Excitatory amino acid transporter 5; excitatory amino acid transporter 5 (retinal glutamate transporter); Retinal glutamate transporter; solute carrier family 1 (glutamate transporter), member 7; Solute carrier family 1 member 7
Gene Aliases: AAAT; EAAT5; SLC1A7
UniProt ID: (Human) O00341
Entrez Gene ID: (Human) 6512
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.