Novus Biologicals
Manufacturer Code:NBP189328
Catalog # NBP189328
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAAT ASCT2M7VS1 ATB(0) Baboon M7 virus receptor M7V1ATBO neutral amino acid transporter B neutral amino acid transporter B(0) R16 RD114 virus receptor RD114/simian type D retrovirus receptor RDR RDRCFLJ31068 Sodium-dependent neutral amino acid transporter type 2 solute carrier family 1 (neutral amino acid transporter) member 5 Solute carrier family 1 member 5; ATB(0); Baboon M7 virus receptor; neutral amino acid transporter B; Neutral amino acid transporter B(0); RD114 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; solute carrier family 1 (neutral amino acid transporter), member 5; Solute carrier family 1 member 5
Gene Aliases: AAAT; ASCT2; ATBO; M7V1; M7VS1; R16; RDR; RDRC; SLC1A5
UniProt ID: (Human) Q15758
Entrez Gene ID: (Human) 6510
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.