Novus Biologicals
Manufacturer Code:NBP169703
Catalog # NBP169703
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC19A3(solute carrier family 19 member 3) The peptide sequence was selected from the middle region of SLC19A3 (NP_079519). Peptide sequence FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: solute carrier family 19 (thiamine transporter), member 3; Solute carrier family 19 member 3; Solute carrier family 19 member 3 solute carrier family 19 member 3 thiamine transporter 2 ThTr2 ThTr-2; solute carrier family 19, member 3; Thiamine transporter 2; ThTr-2
Gene Aliases: BBGD; SLC19A3; THMD2; THTR2
UniProt ID: (Human) Q9BZV2
Entrez Gene ID: (Human) 80704
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.