Novus Biologicals
Manufacturer Code:NBP160014
Catalog # NBP160014
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC17A3(solute carrier family 17 (sodium phosphate) member 3) The peptide sequence was selected from the middle region of SLC17A3. Peptide sequence FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/PI cotransporter 4; Na(+)/PI cotransporter 4 NPT4Sodium/phosphate cotransporter 4 sodium-dependent phosphate transport protein 4 solute carrier family 17 (sodium phosphate) member 3 Solute carrier family 17 member 3; Sodium-dependent phosphate transport protein 4; Sodium/phosphate cotransporter 4; solute carrier family 17 (organic anion transporter), member 3; solute carrier family 17 (sodium phosphate), member 3; Solute carrier family 17 member 3
Gene Aliases: GOUT4; NPT4; SLC17A3; UAQTL4
UniProt ID: (Human) O00476
Entrez Gene ID: (Human) 10786
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.