Novus Biologicals
Manufacturer Code:NBP15963720UL
Catalog # NBP15963720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC15A4(solute carrier family 15 member 4) The peptide sequence was selected from the middle region of SLC15A4 (NP_663623). Peptide sequence GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hPHT1; Peptide transporter 4; Peptide transporter 4 Peptide/histidine transporter 1 PHT1hPHT1 PTR4peptide-histidine transporter 4 solute carrier family 15 member 4 solute carrier family 15 member 4; peptide-histidine transporter 4; Peptide/histidine transporter 1; solute carrier family 15 (oligopeptide transporter), member 4; Solute carrier family 15 member 4; solute carrier family 15, member 4
Gene Aliases: FP12591; PHT1; PTR4; SLC15A4
UniProt ID: (Human) Q8N697
Entrez Gene ID: (Human) 121260
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.