Novus Biologicals
Manufacturer Code:NBP160115
Catalog # NBP160115
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC14A1(solute carrier family 14 (urea transporter) member 1 (Kidd blood group)) The peptide sequence was selected from the C terminal of SLC14A1. Peptide sequence LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ33745 HsT1341 HUT11 JKFLJ41687 RACH1 solute carrier family 14 (urea transporter) member 1 (Kidd blood group) Solute carrier family 14 member 1 truncated urea transporter urea transporter 1 urea transporter JK glycoprotein Urea transporter erythrocyte urea transporter-B1 UT1UT-B1 UTEblood group Kidd urea transporter; Kidd blood group; SLC14A1 JK; solute carrier family 14 (urea transporter), member 1 (Kidd blood group); Solute carrier family 14 member 1; Urea transporter 1; urea transporter JK glycoprotein; Urea transporter, erythrocyte; urea transporter-B1
Gene Aliases: HsT1341; HUT11; JK; RACH1; RACH2; SLC14A1; UT-B1; UT1; UTE
UniProt ID: (Human) B3KR62
Entrez Gene ID: (Human) 6563
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.