Novus Biologicals
Manufacturer Code:NBP213313
Catalog # NBP213313
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYR SHHDQMICKCLSLSI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/sulfate cotransporter SUT-1; Na(+)/sulfate cotransporter SUT-1 NaS2 solute carrier family 13 (sodium/sulfate symporters) member 4 solute carrier family 13 (sodium/sulphate symporters) member 4 sulphate transporter 1 SUT-1 SUT1solute carrier family 13 member 4; NaS2; solute carrier family 13 (sodium/sulfate symporter), member 4; solute carrier family 13 (sodium/sulfate symporters), member 4; solute carrier family 13 (sodium/sulphate symporters), member 4; Solute carrier family 13 member 4; sulphate transporter 1
Gene Aliases: NAS2; SLC13A4; SUT-1; SUT1
UniProt ID: (Human) Q9UKG4
Entrez Gene ID: (Human) 26266
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.