Novus Biologicals
Manufacturer Code:NBP182602
Catalog # NBP182602
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hNaDC3; hNaDC3 Na(+)/dicarboxylate cotransporter 3 NaDC-3 NADC3SDCT2naDC-3 sodium-dependent high affinity dicarboxylate transporter 3 Sodium-dependent high-affinity dicarboxylate transporter 2 solute carrier family 13 (sodium-dependent dicarboxylate transporter) member 3 solute carrier family 13 member 3; Na(+)/dicarboxylate cotransporter 3; NaDC-3; sodium-dependent high affinity dicarboxylate transporter 3; Sodium-dependent high-affinity dicarboxylate transporter 2; Solute carrier family 13 member 3
Gene Aliases: NADC3; SDCT2; SLC13A3
UniProt ID: (Human) Q8WWT9
Entrez Gene ID: (Human) 64849
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.