Novus Biologicals
Manufacturer Code:NBP159699
Catalog # NBP159699
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC12A3(solute carrier family 12 (sodium/chloride transporters) member 3) The peptide sequence was selected from the middle region of SLC12A3. Peptide sequence ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ96318 Na-Cl symporter NCCT solute carrier family 12 (sodium/chloride transporters) member 3 solute carrier family 12 member 3 thiazide-sensitive Na-Cl cotransporter Thiazide-sensitive sodium-chloride cotransporter TSCNaCl electroneutral thiazide-sensitive cotransporter; Na-Cl cotransporter; Na-Cl symporter; NaCl electroneutral thiazide-sensitive cotransporter; NCC; solute carrier family 12 (sodium/chloride transporter), member 3; Solute carrier family 12 member 3; thiazide-sensitive Na-Cl cotransporter; Thiazide-sensitive sodium-chloride cotransporter
Gene Aliases: NCC; NCCT; SLC12A3; TSC
UniProt ID: (Human) P55017
Entrez Gene ID: (Human) 6559
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.