Novus Biologicals
Manufacturer Code:NBP159707
Catalog # NBP159707
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC10A5(solute carrier family 10 (sodium/bile acid cotransporter family) member 5) The peptide sequence was selected from the C terminal of SLC10A5. Peptide sequence GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/bile acid cotransporter 5; Na(+)/bile acid cotransporter 5 P5 sodium/bile acid cotransporter 5 solute carrier family 10 (sodium/bile acid cotransporter family) member 5 Solute carrier family 10 member 5; Sodium/bile acid cotransporter 5; solute carrier family 10 (sodium/bile acid cotransporter family), member 5; Solute carrier family 10 member 5; solute carrier family 10, member 5
Gene Aliases: P5; SLC10A5
UniProt ID: (Human) Q5PT55
Entrez Gene ID: (Human) 347051
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.