Novus Biologicals
Manufacturer Code:NBP157135
Catalog # NBP157135
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLBP(stem-loop (histone) binding protein) The peptide sequence was selected from the middle region of SLBP. Peptide sequence INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hairpin binding protein, histone; histone binding protein; histone histone binding protein histone RNA hairpin-binding protein histone stem-loop binding protein Histone stem-loop-binding protein stem-loop binding protein; Histone RNA hairpin-binding protein; histone stem-loop binding protein; Histone stem-loop-binding protein; stem-loop (histone) binding protein
Gene Aliases: HBP; SLBP
UniProt ID: (Human) Q14493
Entrez Gene ID: (Human) 7884
Molecular Function:
RNA binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.