Novus Biologicals
Manufacturer Code:NBP17412820UL
Catalog # NBP1742820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of SKIP. Immunizing peptide sequence PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3 EC 3.1.3.56 inositol polyphosphate-5-phosphatase K PPS skeletal muscle and kidney enriched inositol phosphatase Skeletal muscle and kidney-enriched inositol phosphatase SKIPinositol polyphosphate 5-phosphatase K; Inositol polyphosphate 5-phosphatase K; Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase; Phosphatidylinositol-4,5-bisphosphate 5-phosphatase; Skeletal muscle and kidney-enriched inositol phosphatase
Gene Aliases: INPP5K; PPS; SKIP
UniProt ID: (Human) Q9BT40
Entrez Gene ID: (Human) 51763
Molecular Function: hydrolase phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.