Novus Biologicals
Manufacturer Code:NBP194007
Catalog # NBP194007
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C15orf23 chromosome 15 open reading frame 23 FLJ14502 HSD11 MGC141728 MGC141729 putative TRAF4-associated factor 1 SKAP small kinetochore associated protein TRAF4 associated factor 1 TRAF4AF1; Kinastrin; Kinetochore-localized astrin-binding protein; kinetochore-localized astrin/SPAG5 binding protein; Kinetochore-localized astrin/SPAG5-binding protein; putative TRAF4-associated factor 1; SKAP; small kinetochore associated protein; Small kinetochore-associated protein; small kinetochore-associated protein, kinetochore-localized astrin-binding protein, TRAF4 associated factor 1; TRAF4 associated factor 1; TRAF4-associated factor 1
Gene Aliases: C15orf23; HSD11; KNSTRN; SKAP; TRAF4AF1
UniProt ID: (Human) Q9Y448
Entrez Gene ID: (Human) 90417
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.