Novus Biologicals
Manufacturer Code:NBP182401
Catalog # NBP182401
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards Six1. Peptide sequence ERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BOS3 deafness autosomal dominant 23 DFNA23 homeobox protein SIX1 sine oculis homeobox (Drosophila) homolog 1 Sine oculis homeobox homolog 1 sine oculis homeobox homolog 1 (Drosophila) SIX homeobox 1 TIP39; Homeobox protein SIX1; Sine oculis homeobox homolog 1
Gene Aliases: BOS3; DFNA23; SIX1; TIP39
UniProt ID: (Human) Q15475
Entrez Gene ID: (Human) 6495
Molecular Function:
helix-turn-helix transcription factor
homeobox transcription factor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.