Novus Biologicals
Manufacturer Code:NBP180002
Catalog # NBP180002
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human SIRT4. Peptide sequence QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.- EC 3.5.1 MGC130046 MGC130047 MGC57437 SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4 sir2-like 4 SIR2-like protein 4 sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) sirtuin (silent mating type information regulation 2 S. cerevisiae homolog) 4 sirtuin 4 sirtuin type 4; NAD-dependent ADP-ribosyltransferase sirtuin-4; NAD-dependent protein deacetylase sirtuin-4; NAD-dependent protein lipoamidase sirtuin-4, mitochondrial; Regulatory protein SIR2 homolog 4; sir2-like 4; SIR2-like protein 4; SIRT4; sirtuin type 4
Gene Aliases: SIR2L4; SIRT4
UniProt ID: (Human) Q9Y6E7
Entrez Gene ID: (Human) 23409
Molecular Function:
DNA binding protein
chromatin/chromatin-binding protein
deacetylase
hydrolase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.