Novus Biologicals
Manufacturer Code:NBP238949
Catalog # NBP238949
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp434K2235 FLJ90319 Histone deacetylase complex subunit Sin3a KIAA0700 paired amphipathic helix protein Sin3a SIN3 homolog A transcription regulator (yeast) SIN3 homolog A transcriptional regulator (yeast) transcriptional co-repressor Sin3A Transcriptional corepressor Sin3a transcriptional regulator SIN3A; Histone deacetylase complex subunit Sin3a; Paired amphipathic helix protein Sin3a; SIN3 homolog A, transcription regulator; SIN3 transcription regulator homolog A; SIN3A; transcriptional co-repressor Sin3A; Transcriptional corepressor Sin3a; transcriptional regulator, SIN3A
Gene Aliases: SIN3A
UniProt ID: (Human) Q96ST3
Entrez Gene ID: (Human) 25942
Molecular Function: DNA binding protein chromatin/chromatin-binding protein deacetylase hydrolase nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.