Novus Biologicals
Manufacturer Code:NBP16236220UL
Catalog # NBP16236220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SI(sucrase-isomaltase (alpha-glucosidase)) The peptide sequence was selected form the middle region of SI. Peptide sequence LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-glucosidase; EC 3.2.1.20 MGC131621 MGC131622 oligosaccharide alpha-16-glucosidase sucrase-isomaltase sucrase-isomaltase (alpha-glucosidase) sucrase-isomaltase intestinal; Isomaltase; oligosaccharide alpha-1,6-glucosidase; Sucrase; sucrase-isomaltase (alpha-glucosidase); Sucrase-isomaltase, intestinal
Gene Aliases: SI
UniProt ID: (Human) P14410
Entrez Gene ID: (Human) 6476
Molecular Function: glucosidase hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.