Novus Biologicals
Manufacturer Code:NBP180754
Catalog # NBP180754
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.2.1 GLY A+ GLYA glycine auxotroph A human complement for hamster Glycine hydroxymethyltransferase serine aldolase serine hydroxymethylase serine hydroxymethyltransferase 2 (mitochondrial) serine hydroxymethyltransferase mitochondrial Serine methylase SHMT threonine aldolase; epididymis secretory sperm binding protein Li 51e; GLY A+; glycine auxotroph A, human complement for hamster; Glycine hydroxymethyltransferase; serine aldolase; serine hydroxymethylase; serine hydroxymethyltransferase 2 (mitochondrial); Serine hydroxymethyltransferase, mitochondrial; Serine methylase; SHMT; threonine aldolase
Gene Aliases: GLYA; HEL-S-51e; SHMT; SHMT2
UniProt ID: (Human) P34897
Entrez Gene ID: (Human) 6472
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.