Novus Biologicals
Manufacturer Code:NBP190454
Catalog # NBP190454
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adapter protein TKS5; adaptor protein TKS5; adaptor protein TKS5 SH3 and PX domains 2A; Five SH3 domain-containing protein; SH3 and PX domain-containing protein 2A; SH3 multiple domains 1; SH3 multiple domains protein 1; Tyrosine kinase substrate with five SH3 domains
Gene Aliases: FISH; KIAA0418; SH3MD1; SH3PXD2A; TKS5
UniProt ID: (Human) Q5TCZ1
Entrez Gene ID: (Human) 9644
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.