Novus Biologicals
Manufacturer Code:NBP186274
Catalog # NBP186274
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Inhibition Assays (IA) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BOG25SH3 domain-binding protein 4 EHB10 EH-binding protein 10 SH3-domain binding protein 4 transferrin receptor trafficking protein Transferrin receptor-trafficking protein TTP; EH-binding protein 10; SH3 domain-binding protein 4; SH3-domain binding protein 4; Transferrin receptor-trafficking protein
Gene Aliases: BOG25; EHB10; SH3BP4; TTP
UniProt ID: (Human) Q9P0V3
Entrez Gene ID: (Human) 23677
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.