Novus Biologicals
Manufacturer Code:NBP19135320UL
Catalog # NBP19135320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hSPP1; hSPPase1; Sphingosine-1-phosphatase 1; Sphingosine-1-phosphate phosphatase 1; Sphingosine-1-phosphate phosphohydrolase 1; SPP-1; spp1; SPPase1
Gene Aliases: SGPP1; SPP1; SPPase1
UniProt ID: (Human) Q9BX95
Entrez Gene ID: (Human) 81537
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.